General Information

  • ID:  hor002120
  • Uniprot ID:  P51459
  • Protein name:  Preptin
  • Gene name:  IGF2
  • Organism:  Equus caballus (Horse)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Equus (genus), Equidae (family), Perissodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005159 insulin-like growth factor receptor binding; GO:0005178 integrin binding; GO:0005179 hormone activity; GO:0008083 growth factor activity; GO:0043539 protein serine/threonine kinase activator activity
  • GO BP:  GO:0000122 negative regulation of transcription by RNA polymerase II; GO:0001503 ossification; GO:0001701 in utero embryonic development; GO:0001892 embryonic placenta development; GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction; GO:0008284 positive regulation of cell population proliferation; GO:0042104 positive regulation of activated T cell proliferation; GO:0043410 positive regulation of MAPK cascade; GO:0045944 positive regulation of transcription by RNA polymerase II; GO:0046628 positive regulation of insulin receptor signaling pathway; GO:0050731 positive regulation of peptidyl-tyrosine phosphorylation
  • GO CC:  NA

Sequence Information

  • Sequence:  DVSTPPTVLPDDSPRYPVVKLFQYNAWKQSTQRL
  • Length:  34
  • Propeptide:  MGIPVGKSLLMLFTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRINRRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTPPTVLPDDSPRYPVVKLFQYNAWKQSTQRLRRGLPALLRTRRGRMLVKELEAFREAQRHRPLIALPTEDPTPHGAAFVEVSSDLQ
  • Signal peptide:  MGIPVGKSLLMLFTFLAFASCCIA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Preptin undergoes glucose-mediated co-secretion with insulin, and acts as physiological amplifier of glucose-mediated insulin secretion. Exhibits osteogenic properties by increasing osteoblast mitogenic activity through phosphoactivation of MAPK1 and MAPK3.
  • Mechanism:  The IGF2 locus is imprinted. Paternal inherited gene is expressed, while the maternal inherited gene is imprinted, hence silenced.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P51459-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002120_AF2.pdbhor002120_ESM.pdb

Physical Information

Mass: 453624 Formula: C180H277N47O53
Absent amino acids: CEGHIM Common amino acids: P
pI: 9.12 Basic residues: 4
Polar residues: 9 Hydrophobic residues: 10
Hydrophobicity: -72.06 Boman Index: -7051
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 71.47
Instability Index: 5437.35 Extinction Coefficient cystines: 8480
Absorbance 280nm: 256.97

Literature

  • PubMed ID:  NA
  • Title:  NA